PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G161100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 527aa    MW: 56684.9 Da    PI: 8.24
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G161100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.3e-14227266241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Seita.9G161100.2.p 227 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 266
                         6899*********************************987 PP

2TCR51.22.4e-16312351140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Seita.9G161100.2.p 312 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 351
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13226267IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538227352IPR005172CRC domain
PfamPF036383.6E-10229264IPR005172CRC domain
SMARTSM011141.5E-14312353IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.1E-12314350IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MMSYLANPSC QWIKETRRIH KKKKFDGSTG CYIQSAADNA HVYCAGATEG VATNHDPEML  60
PGVIQSQLVS NEYFFDTFKV PSDDMALSED QCGRLHRCSL FNEKVGASDM SVQSGSNPHL  120
ANICGDNYLK PAGSPVYALP GIGLHLNAVA SNSSNNMPFT INPPLQPEHN SPTTIVSCSE  180
TGLYSSEVYT RIHDDHSSQK TMPNANESCQ ESHKKKRRKL QNGDGDSCRR CSCKKSKCLK  240
LYCACFAAKV YCSGFCSCQG CLNNHTHEET VSCIRKRTES RNPLAFAPTV TRACDSGSDF  300
GDNSNNTPAS ARHKRGCNCR KSSCLKKYCE CFQSGVGCSM SCRCESCKNS FGKREGVLLL  360
ATAKMEKGAK AKGTRSTEEK LAFDKQDVVG QSGDLPSTEN LFATPSLGPC RSSILPPSTC  420
SEPPLSTAGY SSRLHNSQSP IKADVLLSYF DTCAAEMIVG DGSANIQEVG SSCISSVKVV  480
SPNKKRVSPL HTGTGLSPIG RSGRKLVLKS IPSFPSLTGD ADSEPH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213217KKKRR
2213218KKKRRK
3214218KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982356.20.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLK4A7550.0K4A755_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-66Tesmin/TSO1-like CXC domain-containing protein